PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AHYPO_010412-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Amaranthaceae; Amaranthus
Family MYB
Protein Properties Length: 184aa    MW: 20919.5 Da    PI: 6.5238
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AHYPO_010412-RAgenomeBYUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.58.2e-201865148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd++l ++++q+G ++Wkt+a + g++R++k+c++rw++yl
  AHYPO_010412-RA 18 KGTWTAEEDQKLSNYIQQHGANHWKTVALKAGLNRCGKSCRLRWLNYL 65
                     799*******************************************97 PP

2Myb_DNA-binding53.45.9e-1771116148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ + eE++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l
  AHYPO_010412-RA  71 RGNISDEEEDLIIRLHKLLGNR-WALIAGRLP-GRTDNEIKNYWNSHL 116
                      7899******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.2151365IPR017930Myb domain
SuperFamilySSF466896.97E-3017112IPR009057Homeodomain-like
SMARTSM007171.7E-151767IPR001005SANT/Myb domain
PfamPF002494.6E-171865IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.8E-251972IPR009057Homeodomain-like
CDDcd001674.07E-112065No hitNo description
PROSITE profilePS5129426.46666120IPR017930Myb domain
SMARTSM007172.6E-1670118IPR001005SANT/Myb domain
PfamPF002492.3E-1571116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2573121IPR009057Homeodomain-like
CDDcd001673.51E-1175116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009957Biological Processepidermal cell fate specification
GO:0010053Biological Processroot epidermal cell differentiation
GO:0010091Biological Processtrichome branching
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0048629Biological Processtrichome patterning
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 184 aa     Download sequence    Send to blast
MAPKKGEEGL GKRRIVNKGT WTAEEDQKLS NYIQQHGANH WKTVALKAGL NRCGKSCRLR  60
WLNYLRPNIK RGNISDEEED LIIRLHKLLG NRWALIAGRL PGRTDNEIKN YWNSHLSKKV  120
NQEDTKTEFP AVSAAATPSI EEITEEAMEN EDTEIRIDMN EMFDFSAEGT YGLDWVDRSC  180
ASI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-301612025128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00538DAPTransfer from AT5G40330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010667031.11e-102PREDICTED: transcription factor MYB114-like
SwissprotQ962769e-57MYB23_ARATH; Transcription factor MYB23
TrEMBLS4SEV35e-83S4SEV3_G
TrEMBLS4SEV55e-83S4SEV5_G
TrEMBLO490175e-83O49017_G
STRINGVIT_00s0341g00050.t011e-75(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G40330.13e-57myb domain protein 23